{"product_id":"proteintech-31987-1-ap","title":"Proteintech, 31987-1-AP, SUCNR1\/GPR91 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SUCNR1\/GPR91 (31987-1-AP) by Proteintech is a Polyclonal antibody targeting SUCNR1\/GPR91 in IHC, ELISA applications with reactivity to human, mouse samples\n31987-1-AP targets SUCNR1\/GPR91 in IHC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: mouse kidney tissue, mouse liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSUCNR1 (Succinate Receptor 1), also known as GPR91, belongs to the family of G protein-coupled receptors (GPCRs) (PMID: 26808164). SUCNR1 has been identified as a receptor for the metabolite succinate, which functions as a metabolic stress signal in various tissues, including the liver, kidney, adipose tissue, and retina (PMID: 29968758). SUCNR1 is crucial in linking metabolic stress, inflammation, and energy homeostasis. It mediates signaling through Gq\/GNAQ or Gi\/GNAI second messengers, depending on the cell type and regulated processes.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag34053 Product name: Recombinant human SUCNR1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 282-334 aa of BC030948 Sequence: PLAFLNSVINPVFYFLLGDHFRDMLMNQLRHNFKSLTSFSRWAHELLLSFREK Predict reactive species\nFull Name: succinate receptor 1\nGenBank Accession Number: BC030948\nGene Symbol: SUCNR1\nGene ID (NCBI): 56670\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q9BXA5\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887819083945,"sku":"31987-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-31987-1-ap","provider":"Iright","version":"1.0","type":"link"}