{"product_id":"proteintech-31996-1-ap","title":"Proteintech, 31996-1-AP, CCDC97 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CCDC97 (31996-1-AP) by Proteintech is a Polyclonal antibody targeting CCDC97 in WB, ELISA applications with reactivity to human samples\n31996-1-AP targets CCDC97 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Jurkat cells, RT-4 cells,  HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:8000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCCDC97 is one of CCDC family proteins. Alterations in expression, mutation, and DNA promoter methylation of CCDC family genes have been shown to be associated with the pathogenesis of many diseases, including primary ciliary dyskinesia, infertility, and tumors (PMID: 37182638). It has been reported that CCDC97 may be involved in Coronary artery disease (PMID: 27386823).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag36049 Product name: Recombinant human CCDC97 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 225-343 aa of BC011577 Sequence: LQSYEERELQQRLLQQQEEEEACLEEEEEEEDSDEEDQRSGKDSEAWVPDSEERLILREEFTSRMHQRFLDGKDGDFDYSTVDDNPDFDNLDIVARDEEERYFDEEEPEDAPSPELDGD Predict reactive species\nFull Name: coiled-coil domain containing 97\nObserved Molecular Weight: 51 kDa\nGenBank Accession Number: BC011577\nGene Symbol: CCDC97\nGene ID (NCBI): 90324\nRRID: AB_3670170\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q96F63\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46885997183145,"sku":"31996-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-31996-1-ap","provider":"Iright","version":"1.0","type":"link"}