{"product_id":"proteintech-32022-1-ap","title":"Proteintech, 32022-1-AP, NAXE Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe NAXE (32022-1-AP) by Proteintech is a Polyclonal antibody targeting NAXE in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n32022-1-AP targets NAXE in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, L02 cells,  MCF-7 cells,  NIH\/3T3 cells,  mouse liver tissue,  rat kidney tissue\nPositive IHC detected in: mouse cerebellum tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: A549 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:300-1:1200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNAD(P)H-hydrate epimerase (NAXE, also known as AIBP, YJEFN1, and APOA1BP) catalyzes the interconversion between the S- and R-forms of NAD(P)HX, and essentially supplies the substrate for the stereospecific enzyme NAD(P)HX dehydratase (NAXD) (PMID: 35866541). NAXE variants can cause neurometabolic disorder by disrupting the cellular NAD(P)HX repair system (PMID: 31745726; 27616477).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag35306 Product name: Recombinant human APOA1BP protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 166-288 aa of NM_144772.2 Sequence: LGEMPAEPMTIDELYELVVDAIFGFSFKGDVREPFHSILSVLKGLTVPIASIDIPSGWDVEKGNAGGIQPDLLISLTAPKKSATQFTGRYHYLGGRFVPPALEKKYQLNLPPYPDTECVYRLQ Predict reactive species\nFull Name: apolipoprotein A-I binding protein\nCalculated Molecular Weight: 32 kDa\nObserved Molecular Weight: 29 kDa\nGenBank Accession Number: NM_144772.2\nGene Symbol: APOA1BP\nGene ID (NCBI): 128240\nRRID: AB_3670173\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q8NCW5\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887732838569,"sku":"32022-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-32022-1-ap","provider":"Iright","version":"1.0","type":"link"}