{"product_id":"proteintech-32036-1-ap","title":"Proteintech, 32036-1-AP, ABHD4 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ABHD4 (32036-1-AP) by Proteintech is a Polyclonal antibody targeting ABHD4 in WB, IHC, ELISA applications with reactivity to human, mouse samples\n32036-1-AP targets ABHD4 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, HepG2 cells,  LNCap cells,  SiHa cells,  mouse testis tissue\nPositive IHC detected in: human urothelial carcinoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe alpha\/beta hydrolase structural domain-containing protein 4 (ABHD4) gene is a major regulator of mammalian phospholipid metabolism with hydrolase and lysophospholipase activities. ABHD4 is involved in anoikis resistance and endogenous cannabinoid biosynthesis, and ABHD4-mediated developmental anoikis specifically protects embryonic brains from the consequences of sporadic delamination errors and teratogenic damage.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag36373 Product name: Recombinant human ABHD4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 250-342 aa of BC024779 Sequence: PSGETAFKAMMESFGWARRPMLERIHLIRKDVPITMIYGSDTWIDTSTGKKVKMQRPDSYVRDMEIKGASHHVYADQPHIFNAVVEEICDSVD Predict reactive species\nFull Name: abhydrolase domain containing 4\nCalculated Molecular Weight: 342 aa, 39 kDa\nObserved Molecular Weight: 39 kDa\nGenBank Accession Number: BC024779\nGene Symbol: ABHD4\nGene ID (NCBI): 63874\nRRID: AB_3670176\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q8TB40\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869798846633,"sku":"32036-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-32036-1-ap","provider":"Iright","version":"1.0","type":"link"}