{"product_id":"proteintech-32040-1-ap","title":"Proteintech, 32040-1-AP, CT55 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CT55 (32040-1-AP) by Proteintech is a Polyclonal antibody targeting CT55 in WB, ELISA applications with reactivity to human samples\n32040-1-AP targets CT55 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human testis tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe Cancer\/Testis Antigen (CTA) genes comprise a group of genes whose expression under physiological conditions is restricted to the testis but is activated in many human cancers. CT55 is a new autophagic manipulator to regulate spermatogenesis via selectively interacting with LAMP2 and GABARAP (which are key regulators in the autophagy process) and further fine-tuning their expression. Cancer-testis antigen 55 (CT55) mutation induced male infertility with extreme disruption in sperm production, morphology, and locomotion (PubMed:36481789).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag36155 Product name: Recombinant human CXorf48 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-168 aa of BC020662 Sequence: MLRLLRLALAFYGRTADPAERQGPQQQGLPQGDTQLTTVQGVVTSFCGDYGMIDESIYFSSDVVTGNVPLKVGQKVNVVVEEDKPHYGLRAIKVDVVPRHLYGAGPSDSGTRVLIGCVTSINEDNIYISNSIYFSIAIVSEDFVPYKGDLLEVEYSTEPGISNIKATS Predict reactive species\nFull Name: chromosome X open reading frame 48\nObserved Molecular Weight: 30 kDa\nGenBank Accession Number: BC020662\nGene Symbol: CXorf48\nGene ID (NCBI): 54967\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q8WUE5\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46886920061097,"sku":"32040-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-32040-1-ap","provider":"Iright","version":"1.0","type":"link"}