{"product_id":"proteintech-32043-1-ap","title":"Proteintech, 32043-1-AP, NDFIP2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe NDFIP2 (32043-1-AP) by Proteintech is a Polyclonal antibody targeting NDFIP2 in WB, ELISA applications with reactivity to human samples\n32043-1-AP targets NDFIP2 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A431 cells, K-562 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:8000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNDFIP2 (Nedd4 family interacting protein 2) is a gene encoding a membrane-anchored adapter protein involved in a variety of cellular processes. It regulates protein ubiquitination and degradation by binding to the Nedd4 family of E3 ubiquitin ligases.NDFIP2 has a wide intracellular distribution, including the Golgi, mitochondria, and perinuclear region of the cytoplasm. Its function involves negative regulation of gene expression, negative regulation of protein transport, and positive regulation of protein ubiquitination.\nIn addition, NDFIP2 is associated with a variety of diseases, such as supratentorial ventricular meningiomas in children. In the cardiovascular field, NDFIP2 affects cardiac electrophysiologic function by regulating the degradation of hERG potassium channels. It is also involved in the immune response, affecting T cell function by regulating cytokine signaling pathways. In oncology, NDFIP2 has been found to affect the antiviral response by targeting IFITM3.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag36480 Product name: Recombinant human NDFIP2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-220 aa of NM_019080.2 Sequence: MARRRSQRVCASGPSMLNSARGAPELLRGTATNAEVSAAAAGATGSEELPPGDRGCRNGGGRGPAATTSSTGVAVGAEHGEDSLSRKPDPEPGRMDHHQPGTGRYQVLLNEEDNSESSAIEQPPTSNPAPQIVQAASSAPALETDSSPPPYSSITVEVPTTSDTEVYGEFYPVPPPYSVATSLPTYDEAEKAKAAAMAAAAAETSQRIQEEECPPRDDFS Predict reactive species\nFull Name: Nedd4 family interacting protein 2\nCalculated Molecular Weight: 36kDa，336aa\nObserved Molecular Weight: 39 kDa\nGenBank Accession Number: NM_019080.2\nGene Symbol: NDFIP2\nGene ID (NCBI): 54602\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q9NV92\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887733756073,"sku":"32043-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-32043-1-ap","provider":"Iright","version":"1.0","type":"link"}