{"product_id":"proteintech-32053-1-ap","title":"Proteintech, 32053-1-AP, AGER\/RAGE Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe AGER\/RAGE (32053-1-AP) by Proteintech is a Polyclonal antibody targeting AGER\/RAGE in WB, IHC, ELISA applications with reactivity to mouse, rat samples\n32053-1-AP targets AGER\/RAGE in WB, IHC, ELISA applications and shows reactivity with mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse lung tissue, rat lung tissue\nPositive IHC detected in: rat lung tissue, mouse lung tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nAdvanced glycosylation end product-specific receptor (AGER, also known as RAGE) is a member of the immunoglobulin superfamily of cell surface receptors, which interacts with distinct families of ligands, mediating diverse functions in a broad array of cell types including cellular migration, proliferation, survival and apoptosis (PMID: 12645002; 17425919). It senses endogenous stress signals with a broad ligand repertoire including advanced glycation end products, S100 proteins, high-mobility group box 1 protein\/HMGB1, amyloid beta\/APP oligomers, nucleic acids, phospholipids and glycosaminoglycans (PMID: 19910580; 28627626). It interacts with distinct molecules implicated in homeostasis, development, inflammation, and certain diseases such as diabetes and Alzheimer's disease (PMID: 26253613; 31079281).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Eg1135 Product name: Recombinant Rat AGER\/RAGE protein (His Tag) Source: mammalian cells -derived, pHZ-KIsec-C-6*HIS Tag: C-6*HIS Domain: 23-341 aa of Sequence: GQNITARIGEPLMLSCKGAPKKPTQKLEWKLNTGRTEAWKVLSPQGDPWDSVARILPNGSLLLPAIGIVDEGTFRCRATNRLGKEVKSNYRVRVYQIPGKPEIVNPASELTANVPNKVGTCVSEGSYPAGTLSWHLDGKPLIPDGKGTVVKEETRRHPETGLFTLRSELTVTPAQGGTTPTYSCSFSLGLPRRRPLNTAPIQPRVREPLPPEGIQLLVEPEGGTVAPGGTVTLTCAISAQPPPQIHWIKDGTPLPLAPSPVLLLPEVGHEDEGIYSCVATHPSHGPQESPPVNIRVTETGDEGQAAGSVDGSGLGTLAL Predict reactive species\nFull Name: advanced glycosylation end product-specific receptor\nCalculated Molecular Weight: 43 kDa\nObserved Molecular Weight: 42-55 kDa\nGene Symbol: Ager\nGene ID (NCBI): 81722\nRRID: AB_3670178\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q63495\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868842676393,"sku":"32053-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-32053-1-ap","provider":"Iright","version":"1.0","type":"link"}