{"product_id":"proteintech-32063-1-ap","title":"Proteintech, 32063-1-AP, FBXO16 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe FBXO16 (32063-1-AP) by Proteintech is a Polyclonal antibody targeting FBXO16 in WB, IP, ELISA applications with reactivity to human samples\n32063-1-AP targets FBXO16 in WB, IP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: MCF-7 cells, T-47D cells\nPositive IP detected in: T-47D cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\n\u003cb\u003eBackground Information\u003c\/b\u003e\nFBXO16 is a member of the F-box protein family, which functions as a substrate recognition subunit of the SCF (Skp1-Cullin-F-box) E3 ubiquitin ligase complex.  High expression levels of FBXO16 are associated with better prognosis in cancer patients. For example, in ovarian cancer, patients with higher FBXO16 expression tend to have a more favorable outcome (PMID: 34333526). This suggests that FBXO16 could serve as a potential biomarker for cancer prognosis and therapeutic targeting.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag36230 Product name: Recombinant human FBXO16 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-292 aa of BC074986 Sequence: MMAFAPPKNTDGPKMQTKMSTWTPLNHQLLNDRVFEERRALLGKWFDKWTDSQRRRILTGLLERCSLSQQKFCCRKLQEKIPAEALDFTTKLPRVLSLYIFSFLDPRSLCRCAQVCWHWKNLAELDQLWMLKCLRFNWYINFSPTPFEQGIWKKHYIQMVKELHITKPKTPPKDGFVIADVQLVTSNSPEEKQSPLSAFRSSSSLRKKNNSGEKALPPWRSSDKHPTDIIRFNYLDNRDPMETVQQGRRKRNQMTPDFSRQSHDKKNKLQDRTRLRKAQSMMSRRNPFPLCP Predict reactive species\nFull Name: F-box protein 16\nCalculated Molecular Weight: 292 aa, 35 kDa\nObserved Molecular Weight: 35 kDa\nGenBank Accession Number: BC074986\nGene Symbol: FBXO16\nGene ID (NCBI): 157574\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q8IX29\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887636467881,"sku":"32063-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-32063-1-ap","provider":"Iright","version":"1.0","type":"link"}