{"product_id":"proteintech-32069-1-ap","title":"Proteintech, 32069-1-AP, SLC66A2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SLC66A2 (32069-1-AP) by Proteintech is a Polyclonal antibody targeting SLC66A2 in WB, ELISA applications with reactivity to human, mouse samples\n32069-1-AP targets SLC66A2 in WB, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse liver tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:200-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSLC66A2 is a member of the solute carrier (SLC) family, which plays a significant role in the transport of a variety of molecules across cell and organelle membranes. SLC66A2 is predicted to be involved in phospholipid translocation and retrograde transport, specifically from the endosome to the Golgi apparatus.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag34417 Product name: Recombinant human SLC66A2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 188-231 aa of BC030140 Sequence: PQLYRNHRHQSTEGMSIKMVLMWTSGDAFKTAYFLLKGAPLQFS Predict reactive species\nFull Name: Solute carrier family 66 member 2\nCalculated Molecular Weight: 30 kDa, 271 aa\nObserved Molecular Weight: 37 kDa\nGenBank Accession Number: BC030140\nGene Symbol: PQLC1\nGene ID (NCBI): 80148\nRRID: AB_3670184\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q8N2U9\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887807549609,"sku":"32069-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-32069-1-ap","provider":"Iright","version":"1.0","type":"link"}