{"product_id":"proteintech-32075-1-ap","title":"Proteintech, 32075-1-AP, FRY Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe FRY (32075-1-AP) by Proteintech is a Polyclonal antibody targeting FRY in WB, IHC, IF\/ICC, ELISA applications with reactivity to human samples\n32075-1-AP targets FRY in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: THP-1 cells, RT-4 cells\nPositive IHC detected in: human pancreas cancer tissue, human urothelial carcinoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: THP-1 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunohistochemistry (IHC): IHC : 1:150-1:600\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe FRY gene encodes a protein involved in cell cycle regulation and DNA damage response. It plays a crucial role in the G2\/M checkpoint, ensuring cells complete DNA repair before entering mitosis by activating the ATR-CHK1 signaling pathway. FRY is expressed in various tissues, including brain, liver, and testis, with notable expression in Sertoli and spermatogonial cells. Aberrant FRY function is associated with multiple diseases, such as cancer and neurodegenerative disorders. In cancer cells, FRY expression can influence proliferation and survival. Understanding FRY's role in cell cycle control and genome stability is vital for elucidating disease mechanisms and developing targeted therapies.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag34959 Product name: Recombinant human FRY protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 2534-2680 aa of NM_023037 Sequence: LEHSDLIMTLSPSEETNPMELLTTACDSTPAEPHSFNTRMSSFDASLPDMNNLQISEGSKAEAVREEEDTTVHEDDLSSSINELPAAFECSDSFSLDMTEGEEKGNRALDQFTLASFGEGDRGVSPPPSPFFSAILAAFQPAACDDA Predict reactive species\nFull Name: furry homolog (Drosophila)\nCalculated Molecular Weight: 339 kDa\nObserved Molecular Weight: 340 kDa\nGenBank Accession Number: NM_023037\nGene Symbol: FRY\nGene ID (NCBI): 10129\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q5TBA9\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887643676841,"sku":"32075-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-32075-1-ap","provider":"Iright","version":"1.0","type":"link"}