{"product_id":"proteintech-32117-1-ap","title":"Proteintech, 32117-1-AP, SBK2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SBK2 (32117-1-AP) by Proteintech is a Polyclonal antibody targeting SBK2 in WB, IF\/ICC, ELISA applications with reactivity to human samples\n32117-1-AP targets SBK2 in WB, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, HepG2 cells,  Kasumi-1 cells\nPositive IF\/ICC detected in: A549 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSH3 domain binding kinase family member 2 (SBK2, also known as SGK069), is an evolutionarily conserved putative serine\/threonine protein kinase that plays a crucial role in cardiomyocyte differentiation, particularly in the formation and maintenance of sarcomeres. It is highly atrium-enriched and is muscle-specific, indicating its specialized function in cardiac muscle cells (PMID: 35587025). SBK2 may be useful for identifying and co-registering tumor borders during surgical resection (PMID: 23730413).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag37233 Product name: Recombinant human SBK2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 185-348 aa of NM_001101401 Sequence: KPENVLVCDPACRRFKLTDFGHTRPRGTLLRLAGPPIPYTAPELCAPPPLPEGLPIQPALDAWALGVLLFCLLTGYFPWDRPLAEADPFYEDFLIWQASGQPRDRPQPWFGLAAAADALLRGLLDPHPRRRSAVIAIREHLGRPWRQREGEAEAVGAVEEEAGQ Predict reactive species\nFull Name: SH3-binding domain kinase family, member 2\nCalculated Molecular Weight: 38 kDa\nObserved Molecular Weight: 30 kDa\nGenBank Accession Number: NM_001101401\nGene Symbol: SBK2\nGene ID (NCBI): 646643\nRRID: AB_3670197\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: P0C263\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887793033385,"sku":"32117-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-32117-1-ap","provider":"Iright","version":"1.0","type":"link"}