{"product_id":"proteintech-32148-1-ap","title":"Proteintech, 32148-1-AP, CD107b \/ LAMP2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CD107b \/ LAMP2 (32148-1-AP) by Proteintech is a Polyclonal antibody targeting CD107b \/ LAMP2 in WB, IHC, IF\/ICC, ELISA applications with reactivity to mouse, rat samples\n32148-1-AP targets CD107b \/ LAMP2 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: NIH\/3T3 cells, Neuro-2a cells,  RAW 264.7 cells,  mouse liver tissue,  rat liver tissue\nPositive IHC detected in: mouse liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: NIH\/3T3 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:200-1:800\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nLAMP2 (CD107b) is a Lysosomal membrane glycoprotein. LAMP2 is extensively glycosylated with asparagine-linked oligosaccharides which protect it from intracellular proteolysis (PMID: 10521503). Although LAMP-2 is localized primarily in the endosome-lysosomal membrane of cells, it is also found on the plasma membrane under certain circumstances, e.g., after platelet activation, during granulocytic differentiation and activation, and in some tumor cells (PMID: 12221139). LAMP2 is involved in lysosomal stability and autophagy (PMID: 12221139). This glycoprotein provides selectins with carbohydrate ligands. LAMP2 may play a role in tumor cell metastasis (PMID 9426697).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Eg2029 Product name: Recombinant Mouse CD107b\/LAMP2 protein (rFc Tag)(HPLC verified) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 26-379 aa of NM_001017959.2 Sequence: LIVNLTDSKGTCLYAEWEMNFTITYETTNQTNKTITIAVPDKATHDGSSCGDDRNSAKIMIQFGFAVSWAVNFTKEASHYSIHDIVLSYNTSDSTVFPGAVAKGVHTVKNPENFKVPLDVIFKCNSVLTYNLTPVVQKYWGIHLQAFVQNGTVSKNEQVCEEDQTPTTVAPIIHTTAPSTTTTLTPTSTPTPTPTPTPTVGNYSIRNGNTTCLLATMGLQLNITEEKVPFIFNINPATTNFTGSCQPQSAQLRLNNSQIKYLDFIFAVKNEKRFYLKEVNVYMYLANGSAFNISNKNLSFWDAPLGSSYMCNKEQVLSVSRAFQINTFNLKVQPFNVTKGQYSTAQDCSADEDN Predict reactive species\nFull Name: lysosomal-associated membrane protein 2\nCalculated Molecular Weight: 46 kDa\nObserved Molecular Weight: 70-100 kDa\nGenBank Accession Number: NM_001017959.2\nGene Symbol: CD107b \/ LAMP2\nGene ID (NCBI): 16784\nRRID: AB_3670208\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: P17047-1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46886045974697,"sku":"32148-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-32148-1-ap","provider":"Iright","version":"1.0","type":"link"}