{"product_id":"proteintech-32206-1-ap","title":"Proteintech, 32206-1-AP, C1QL2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe C1QL2 (32206-1-AP) by Proteintech is a Polyclonal antibody targeting C1QL2 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n32206-1-AP targets C1QL2 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, rat brain tissue\nPositive IHC detected in: rat brain tissue, mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nComplement C1q-like protein 2 (C1QL2, also known as CTRP10) is a member of the C1q-like protein family. It is a secreted protein that plays a role in synaptic organization and function. C1QL2 is involved in the formation and maintenance of synapses, particularly in the central nervous system (CNS) (PMID: 20646056). It interacts with specific neurexin-3 isoforms to recruit synaptic vesicles and modulate synaptic transmission. Additionally, C1QL2 has been implicated in the regulation of hippocampal mossy fiber-CA3 synapse function, suggesting its role in synaptic plasticity and memory formation (PMID: 28219683).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag37614 Product name: Recombinant human C1QL2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 22-80 aa of NM_182528 Sequence: HYEMMGTCRMICDPYTAAPGGEPPGAKAQPPGPSTAALEVMQDLSANPPPPFIQGPKGD Predict reactive species\nFull Name: complement component 1, q subcomponent-like 2\nCalculated Molecular Weight: 29 kDa\nObserved Molecular Weight: 35 kDa\nGenBank Accession Number: NM_182528\nGene Symbol: C1QL2\nGene ID (NCBI): 165257\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q7Z5L3\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46885547671721,"sku":"32206-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-32206-1-ap","provider":"Iright","version":"1.0","type":"link"}