{"product_id":"proteintech-32231-1-ap","title":"Proteintech, 32231-1-AP, WNK3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe WNK3 (32231-1-AP) by Proteintech is a Polyclonal antibody targeting WNK3 in WB, ELISA applications with reactivity to human samples\n32231-1-AP targets WNK3 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, HEK-293T cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:8000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nWNK3, is a member of the WNK (With No Lysine [K]) kinase family. It is a serine\/threonine kinase that plays important roles in various physiological processes. WNK3 is expressed in brain, lung, kidney, liver and pancreas, and in fetal tissues including placenta, fetal brain, lung and kidney. Very low levels of expression were also detected in fetal heart, thymus, liver and spleen. Isoform 1 is brain-specific. Isoform 3 is kidney-specific. Endogenous WNK3 protein is an active protein kinase when immunoprecipitated from cells and its overexpression increases the survival of HeLa cells by delaying the onset of apoptosis (PMID:16501604).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag37713 Product name: Recombinant mouse WNK3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 500-650 aa of NM_001002838 Sequence: AGCLEERRDSQCKSMGNVFPQPQNTTLPLAPAQQTGAECEETEVDQHVRQQLLQRKPQQHCSSVTGDNLSEAGAASVIHSDTSSQPSVAYSSNQTMGSQMVSNIPQAEVNVPGQIYSSQQLVGHYQQVSGLQKHSKLTQPQILPLVQGQST Predict reactive species\nFull Name: WNK lysine deficient protein kinase 3\nCalculated Molecular Weight: 1800aa, 198 kDa\nObserved Molecular Weight: 230 kDa\nGenBank Accession Number: NM_001002838\nGene Symbol: WNK3\nGene ID (NCBI): 65267\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q9BYP7\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887924269225,"sku":"32231-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-32231-1-ap","provider":"Iright","version":"1.0","type":"link"}