{"product_id":"proteintech-32262-1-ap","title":"Proteintech, 32262-1-AP, MYOM2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MYOM2 (32262-1-AP) by Proteintech is a Polyclonal antibody targeting MYOM2 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n32262-1-AP targets MYOM2 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: rat skeletal muscle tissue, mouse heart tissue,  mouse skeletal muscle tissue,  rat heart tissue\nPositive IHC detected in: mouse heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMyomesin proteins comprise three family members encoded by MYOM1, MYOM2 and MYOM3, and localize to the M-band of the sarcomere. These three myomesin isoforms correlate with the contractile properties in different fiber types. MYOM1 is expressed in all striated muscles, whereas MYOM2 is expressed in the adult heart and fast fibers, and MYOM3 is expressed only in skeletal muscle intermediate fiber types (PMID:14609030;26792323;15890201).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag35659 Product name: Recombinant human MYOM2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-200 aa of NM_003970.3 Sequence: MSLVTVPFYQKRHRHFDQSYRNIQTRYLLDEYASKKRASTQASSQKSLSQRSSSQRASSQTSLGGTICRVCAKRVSTQEDEEQENRSRYQSLVAAYGEAKRQRFLSELAHLEEDVHLARSQARDKLDKYAIQQMMEDKLAWERHTFEERISRAPEILVRLRSHTVWERMSVKLCFTVQGFPTPVVQWYKDGSLICQAAEP Predict reactive species\nFull Name: myomesin (M-protein) 2, 165kDa\nCalculated Molecular Weight: 165kDa，1465aa\nObserved Molecular Weight: 165 kDa\nGenBank Accession Number: NM_003970.3\nGene Symbol: MYOM2\nGene ID (NCBI): 9172\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: P54296\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887731232937,"sku":"32262-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-32262-1-ap","provider":"Iright","version":"1.0","type":"link"}