{"product_id":"proteintech-32288-1-ap","title":"Proteintech, 32288-1-AP, ZNF530 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ZNF530 (32288-1-AP) by Proteintech is a Polyclonal antibody targeting ZNF530 in WB, ELISA applications with reactivity to human samples\n32288-1-AP targets ZNF530 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, IMR-32 cells,  U-251 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nZNF530, also known as zinc finger protein 530, is a member of the zinc finger protein family. ZNF530 is expressed in various tissues, including the brain, heart, liver, and pancreas. It has been shown to play a role in the development and progression of cancer, as well as in the regulation of normal cell development and function.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag37782 Product name: Recombinant human ZNF530 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-200 aa of BC060865 Sequence: MAAALRAPTQQVFVAFEDVAIYFSQEEWELLDEMQRLLYRDVMLENFAVMASLGCWCGAVDEGTPSAESVSVEELSQGRTPKADTSTDKSHPCEICTPVLRDILQMIELQASPCGQKLYLGGAPRDFWMSSNLHQLQKLDNGEKLFKVDGDQASFMMNCRFHVSGKPFTFGEVGRDFSATSGLLQHQVTPTIERPHSRIR Predict reactive species\nFull Name: zinc finger protein 530\nCalculated Molecular Weight: 599 aa, 69 kDa\nObserved Molecular Weight: 70 kDa\nGenBank Accession Number: BC060865\nGene Symbol: ZNF530\nGene ID (NCBI): 348327\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q6P9A1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887949500585,"sku":"32288-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-32288-1-ap","provider":"Iright","version":"1.0","type":"link"}