{"product_id":"proteintech-32300-1-ap","title":"Proteintech, 32300-1-AP, MEGF8 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MEGF8 (32300-1-AP) by Proteintech is a Polyclonal antibody targeting MEGF8 in WB, ELISA applications with reactivity to human samples\n32300-1-AP targets MEGF8 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: COLO 320 cells, HepG2 cells,  U-251 cells,  U2OS cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMultiple epidermal growth factor-like domains protein 8 (MEGF8, also known as C19orf49, EGFL4, and KIAA0817) is a multidomain transmembrane protein, which is known to interact with MGRN1, a protein that functions as an E3 ubiquitin ligase, and this interaction is involved in the regulation of Hedgehog signaling and heart development (PMID: 32966817). It is also involved in mediating Bone morphogenetic protein 4 (BMP4) signaling and guidance of developing trigeminal ganglion (TG) axons (PMID: 24052814). Immunoelectron microscopy showed that MEGF8 was present in the synapses and around the outer mitochondrial membrane, indicating its role in synaptic and mitochondrial functions (PMID: 38201267).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag36469 Product name: Recombinant human MEGF8 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 2442-2647 aa of NM_001271938.1 Sequence: YRLISVEQECCLDPTSQTNCFHEPKRRALGPGRTVLFGVQPKFTNVDIRLTLDVTFGAVDLYVSTSYDTFVVRVAPDTGVHTVHIQPPPAPPPPPPPADGGPRGAGDPGGAGASSGPGAPAEPRVREVWPRGLITYVTVTEPSAVLVVRGVRDRLVITYPHEHHALKSSRFYLLLLGVGDPSGPGANGSADSQGLLFFRQDQAHID Predict reactive species\nFull Name: multiple EGF-like-domains 8\nCalculated Molecular Weight: 303 kDa\nObserved Molecular Weight: 303 kDa\nGenBank Accession Number: NM_001271938.1\nGene Symbol: MEGF8\nGene ID (NCBI): 1954\nRRID: AB_3670233\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q7Z7M0\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887716651177,"sku":"32300-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-32300-1-ap","provider":"Iright","version":"1.0","type":"link"}