{"product_id":"proteintech-32304-1-ap","title":"Proteintech, 32304-1-AP, MESP1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MESP1 (32304-1-AP) by Proteintech is a Polyclonal antibody targeting MESP1 in WB, ELISA applications with reactivity to human, rat samples\n32304-1-AP targets MESP1 in WB, ELISA applications and shows reactivity with human, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: rat skeletal muscle tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMESP1 is a transiently expressed bHLH transcription factor that serves as a master regulator of mesoderm formation and cardiac lineage specification during early embryogenesis. By activating core cardiovascular transcriptional networks and promoting mesodermal cell migration, MESP1 establishes the foundation for heart development. Perturbation of MESP1 function leads to defective mesoderm patterning and congenital heart disease, underscoring its pivotal role in early developmental programming.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag38017 Product name: Recombinant human MESP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-72 aa of BC006219 Sequence: MAQPLCPPLSESWMLSAAWGPTRRPPPSDKDCGRSLVSSPDSWGSTPADSPVASPARPGTLRDPRAPSVGRR Predict reactive species\nFull Name: mesoderm posterior 1 homolog (mouse)\nCalculated Molecular Weight: 268 aa, 29 kDa\nObserved Molecular Weight: 31 kDa\nGenBank Accession Number: BC006219\nGene Symbol: MESP1\nGene ID (NCBI): 55897\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q9BRJ9\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887717372073,"sku":"32304-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-32304-1-ap","provider":"Iright","version":"1.0","type":"link"}