{"product_id":"proteintech-32346-1-ap","title":"Proteintech, 32346-1-AP, Ly-6G Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Ly-6G (32346-1-AP) by Proteintech is a Polyclonal antibody targeting Ly-6G in WB, FC, ELISA applications with reactivity to mouse samples\n32346-1-AP targets Ly-6G in WB, IF, FC, ELISA applications and shows reactivity with mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse bone marrow\nPositive FC detected in: mouse bone marrow cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nFlow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nLy-6G (lymphocyte antigen 6 complex, locus G), also known as Gr-1, is a 21-25 kDa, glycosylphosphatidylinositol-anchored protein expressed on myeloid lineage cells in mouse bone marrow (PMID: 8360469). The expression of Ly-6G increases on neutrophils as they differentiate from immature cells in the bone marrow to mature cells in the blood and spleen (PMID: 8890901).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: mouse\nCited Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Eg2609 Product name: Recombinant Mouse Ly6g protein (rFc Tag) Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 21-114 aa of NM_001310438.1 Sequence: AERAQGLECYNCIGVPPETSCNTTTCPFSDGFCVALEIEVIVDSHRSKVKSNLCLPICPTTLDNTEITGNAVNVKTYCCKEDLCNAAVPTGGSS Predict reactive species\nFull Name: lymphocyte antigen 6 complex, locus G\nCalculated Molecular Weight: 14 kDa\nObserved Molecular Weight: 20-30 kDa\nGenBank Accession Number: NM_001310438.1\nGene Symbol: Ly-6G\nGene ID (NCBI): 546644\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: P35461\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869556527273,"sku":"32346-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-32346-1-ap","provider":"Iright","version":"1.0","type":"link"}