{"product_id":"proteintech-32377-1-ap","title":"Proteintech, 32377-1-AP, RIC1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe RIC1 (32377-1-AP) by Proteintech is a Polyclonal antibody targeting RIC1 in WB, IP, ELISA applications with reactivity to human samples\n32377-1-AP targets RIC1 in WB, IP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse pancreas tissue, rat pancreas\nPositive IP detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\n\u003cb\u003eBackground Information\u003c\/b\u003e\nRIC1 (RAB6A GEF complex partner 1) is a protein that plays a critical role in intracellular membrane trafficking. It encodes a protein of 1056 amino acid (aa) residues, including a putative nuclear localisation sequence (PMID: 9099877). Ric1 is composed of two β-propellers and a C-terminal α-solenoid domain that remodels the Rab6 nucleotide-binding pocket to facilitate nucleotide exchange (PMID: 39632878). RIC1 proteins play important roles in vesicular trafficking, regulation of membrane dynamics, cell division and signalling, and are essential for maintaining normal cellular function.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag36426 Product name: Recombinant human KIAA1432 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 820-1054 aa of BC136616 Sequence: QTVVHCARKTEYALWNYLFAAVGNPKDLFEECLMAQDLDTAASYLIILQNMEVPAVSRQHATLLFNTALEQGKWDLCRHMIRFLKAIGSGESETPPSTPTAQEPSSSGGFEFFRNRSISLSQSAENVPASKFSLQKTLSMPSGPSGKRWSKDSDCAENMYIDMMLWRHARRLLEDVRLKDLGCFAAQLGFELISWLCKERTRAARVDNFVIALKRLHKDFLWPLPIIPASSISSP Predict reactive species\nFull Name: KIAA1432\nObserved Molecular Weight: 150 kDa\nGenBank Accession Number: BC136616\nGene Symbol: KIAA1432\nGene ID (NCBI): 57589\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q4ADV7\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887784841385,"sku":"32377-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-32377-1-ap","provider":"Iright","version":"1.0","type":"link"}