{"product_id":"proteintech-32429-1-ap","title":"Proteintech, 32429-1-AP, ORC3L Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ORC3L (32429-1-AP) by Proteintech is a Polyclonal antibody targeting ORC3L in WB, ELISA applications with reactivity to human samples\n32429-1-AP targets ORC3L in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nORC3L, also known as Origin Recognition Complex Subunit 3-like, is a human gene that encodes a protein which is a subunit of the Origin Recognition Complex (ORC). The ORC is a highly conserved six-subunit protein complex that is essential for the initiation of DNA replication in eukaryotic cells. Studies in yeast have shown that ORC binds specifically to origins of replication and serves as a platform for the assembly of additional initiation factors such as Cdc6 and Mcm proteins.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag37481 Product name: Recombinant human ORC3L protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 14-207 aa of NM_012381.3 Sequence: KPNSKKRKISLPIEDYFNKGKNEPEDSKLRFETYQLIWQQMKSENERLQEELNKNLFDNLIEFLQKSHSGFQKNSRDLGGQIKLREIPTAALVLGVNVTDHDLTFGSLTEALQNNVTPYVVSLQAKDCPDMKHFLQKLISQLMDCCVDIKSKEEESVHVTQRKTHYSMDSLSSWYMTVTQKTDPKMLSKKRTTS Predict reactive species\nFull Name: origin recognition complex, subunit 3-like (yeast)\nCalculated Molecular Weight: 66 kDa, 82 kDa\nObserved Molecular Weight: 66 kDa, 82 kDa\nGenBank Accession Number: NM_012381.3\nGene Symbol: ORC3L\nGene ID (NCBI): 23595\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q9UBD5\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887746732201,"sku":"32429-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-32429-1-ap","provider":"Iright","version":"1.0","type":"link"}