{"product_id":"proteintech-32435-1-ap","title":"Proteintech, 32435-1-AP, CD107a \/ LAMP1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CD107a \/ LAMP1 (32435-1-AP) by Proteintech is a Polyclonal antibody targeting CD107a \/ LAMP1 in WB, IF\/ICC, ELISA applications with reactivity to mouse, rat samples\n32435-1-AP targets CD107a \/ LAMP1 in WB, IF\/ICC, ELISA applications and shows reactivity with mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: NIH\/3T3 cells, C6 cells,  HSC-T6 cells,  rat kidney tissue,  RAW 264.7 cells\nPositive IF\/ICC detected in: NIH\/3T3 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:250-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nLAMP1 (also known as CD107a) is a 90-120 kDa heavily glycosylated membrane protein enriched in the lysosomal membrane. LAMP1 functions to provide selectins with carbohydrate ligands. This protein has also been shown to be a marker of degranulation on lymphocytes such as CD8+ and NK cells and may also play a role in tumor cell differentiation and metastasis.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag34623 Product name: Recombinant mouse Lamp1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-190 aa of NM_001317353 Sequence: MAAPGARRPLLLLLLAGLAHGASALFEVKNNGTTCIMASFSASFLTTYETANGSQIVNISLPASAEVLKNGSSCGKENVSDPSLTITFGRGYLLTLNFTKNTTRYSVQHMYFTYNLSDTEHFPNAISKEIYTMDSTTDIKADINKAYRCVSDIRVYMKNVTVVLRDATIQAYLSSGNFSKEETHCTQDGP Predict reactive species\nFull Name: lysosomal-associated membrane protein 1\nCalculated Molecular Weight: 44 kDa\nObserved Molecular Weight: 90-120 kDa\nGenBank Accession Number: NM_001317353\nGene Symbol: CD107a\nGene ID (NCBI): 16783\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: P11438\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46886042665129,"sku":"32435-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-32435-1-ap","provider":"Iright","version":"1.0","type":"link"}