{"product_id":"proteintech-32498-1-ap","title":"Proteintech, 32498-1-AP, ORM1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ORM1 (32498-1-AP) by Proteintech is a Polyclonal antibody targeting ORM1 in WB, ELISA applications with reactivity to mouse samples\n32498-1-AP targets ORM1 in WB, ELISA applications and shows reactivity with mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse kidney tissue, PNGF treated mouse kidney tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nOrosomucoid-1 (ORM1), also called Alpha-1-acid glycoprotein 1 (AGP1), is a glycoprotein synthesized mostly by hepatocytes. ORM1 is an acute-phase reactant protein controlled by glucocorticoids, interleukin-1 and interleukin-6, and increase up to 5-50 times upon infection and\/or inflammation. Anti-apoptotic effect and role as immunomodulator of ORM have been reported. ORM is an important carrier for synthetic drugs and influences their distribution and availability in the body. This antibody recognizes a band about 44 kDa in mouse kidneys which is due to the glycosylation of ORM1.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Eg2752 Product name: Recombinant Mouse ORM1 protein (rFc Tag) (HPLC verified) Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 19-207 aa of NM_008768.2 Sequence: QNPEHANFTIGEPITNETLSWLSDKWFFMGAAFRKLEYRQAIQTMQSEFFYLTTNLINDTIELRESQTIGDQCVYNSTHLGFQRENGTFSKYEGGVETFAHLIVLRKHGAFMLAFDLKDEKKRGLSLYAKRPDITPELREVFQKAVTHVGMDESEIIFVDWKKDRCGQQEKKQLELGKETKKDPEEGQA Predict reactive species\nFull Name: orosomucoid 1\nCalculated Molecular Weight: 24 kDa\nObserved Molecular Weight: 23-44 kDa\nGenBank Accession Number: NM_008768.2\nGene Symbol: Orm1\nGene ID (NCBI): 18405\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q60590\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887746896041,"sku":"32498-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-32498-1-ap","provider":"Iright","version":"1.0","type":"link"}