{"product_id":"proteintech-32596-1-ap","title":"Proteintech, 32596-1-AP, IL-27A p28 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe IL-27A p28 (32596-1-AP) by Proteintech is a Polyclonal antibody targeting IL-27A p28 in WB, ELISA applications with reactivity to mouse samples\n32596-1-AP targets IL-27A p28 in WB, ELISA applications and shows reactivity with mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: IL-27A Recombinant protein Eg5066, IL-27 Recombinant protein (Cat No.Eg0897)\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nIL-27, as a member of the IL-6\/IL-12 family, is a heterodimeric cytokine composed of two subunits: p28 (IL-27a) and EBI3 (IL-27b). IL-27 acts on various cell types, including T cells, B cells, macrophages, dendritic cells, natural killer (NK) cells and non-hematopoietic cells. IL-27 plays a critical role in the early regulation of T helper type 1 initiation, and enhances proliferation of naive CD4+T cells and naive B cells. It, however, also exerts anti-inflammatory functions by inhibiting the development of Th17 cells and inducing IL-10 producing type 1 regulatory T cells. IL-27 is a potentially promising cytokine for therapeutic approaches on various human diseases.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Eg0897 Product name: Recombinant Mouse IL-27A protein (His Tag) Source: mammalian cells -derived, pHZ-KIsec-C-6*HIS Tag: C-10*His Domain: 29-234 aa of Sequence: FPTDPLSLQELRREFTVSLYLARKLLSEVQGYVHSFAESRLPGVNLDLLPLGYHLPNVSLTFQAWHHLSDSERLCFLATTLRPFPAMLGGLGTQGTWTSSEREQLWAMRLDLRDLHRHLRFQVLAAGFKCSKEEEDKEEEEEEEEEEKKLPLGALGGPNQVSSQVSWPQLLYTYQLLHSLELVLSRAVRDLLLLSLPRRPGSAWDS Predict reactive species\nFull Name: interleukin 27\nGene Symbol: Il27\nGene ID (NCBI): 50498\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: O35228(IL27B)+Q8K3I6(IL27A)\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887680245929,"sku":"32596-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-32596-1-ap","provider":"Iright","version":"1.0","type":"link"}