{"product_id":"proteintech-32621-1-ap","title":"Proteintech, 32621-1-AP, CD134\/OX40 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CD134\/OX40 (32621-1-AP) by Proteintech is a Polyclonal antibody targeting CD134\/OX40 in WB, IHC, ELISA applications with reactivity to mouse, rat samples\n32621-1-AP targets CD134\/OX40 in WB, IHC, ELISA applications and shows reactivity with mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Con A treated rat splenocytes, Con A treated mouse splenocytes\nPositive IHC detected in: mouse spleen tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCD134 (OX40) is a member of the TNFR-superfamily of receptors. Predominantly expressed on activated T cells, CD134 is activated by its cognate ligand CD134L (OX40L) and functions as a T cell co-stimulatory molecule. CD134-CD134L interactions have been proposed as a potential therapeutic target for treating autoimmunity (PMID: 26215166). CD134 can interact with TRAF2, TRAF3, and TRAF5.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Eg2936 Product name: Recombinant Mouse CD134\/OX40 protein (rFc Tag) Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 20-211 aa of NM_011659.2 Sequence: VTARRLNCVKHTYPSGHKCCRECQPGHGMVSRCDHTRDTLCHPCETGFYNEAVNYDTCKQCTQCNHRSGSELKQNCTPTQDTVCRCRPGTQPRQDSGYKLGVDCVPCPPGHFSPGNNQACKPWTNCTLSGKQTRHPASDSLDAVCEDRSLLATLLWETQRPTFRPTTVQSTTVWPRTSELPSPPTLVTPEGP Predict reactive species\nFull Name: tumor necrosis factor receptor superfamily, member 4\nCalculated Molecular Weight: 30 kDa\nObserved Molecular Weight: 50 kDa\nGenBank Accession Number: NM_011659.2\nGene Symbol: CD134\nGene ID (NCBI): 22163\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: P47741\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46886075793577,"sku":"32621-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-32621-1-ap","provider":"Iright","version":"1.0","type":"link"}