{"product_id":"proteintech-32673-1-ap","title":"Proteintech, 32673-1-AP, IFN alpha2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe IFN alpha2 (32673-1-AP) by Proteintech is a Polyclonal antibody targeting IFN alpha2 in WB, ELISA applications with reactivity to mouse samples\n32673-1-AP targets IFN alpha2 in WB, ELISA applications and shows reactivity with mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Recombinant protein\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nIFN-alpha2 (Interferon-alpha 2) is a subtype of the Type I interferon family, which plays a critical role in the immune response to viral infections and certain cancers. It is a cytokine that signals through the IFNAR receptor complex (IFNAR1 and IFNAR2) to activate the JAK-STAT signaling pathway, leading to the expression of interferon-stimulated genes (ISGs). These genes have antiviral, antiproliferative, and immunomodulatory effects.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Eg3079 Product name: Recombinant Mouse IFN-alpha 2\/IFNA2 protein (rFc Tag) (HPLC verified) Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 24-190 aa of Sequence: CDLPHTYNLRNKRALKVLAQMRRLPFLSCLKDRQDFGFPLEKVDNQQIQKAQAIPVLRDLTQQTLNLFTSKASSAAWNATLLDSFCNDLHQQLNDLQTCLMQQVGVQEPPLTQEDALLAVRKYFHRITVYLREKKHSPCAWEVVRAEVWRALSSSVNLLPRLSEEKE Predict reactive species\nFull Name: interferon alpha 2\nCalculated Molecular Weight: 22 kDa\nGene Symbol: Ifna2\nGene ID (NCBI): 15965\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: P01573\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887676379305,"sku":"32673-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-32673-1-ap","provider":"Iright","version":"1.0","type":"link"}