{"product_id":"proteintech-32681-1-ap","title":"Proteintech, 32681-1-AP, S100A8 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe S100A8 (32681-1-AP) by Proteintech is a Polyclonal antibody targeting S100A8 in WB, IF\/ICC, IP, ELISA applications with reactivity to mouse, rat samples\n32681-1-AP targets S100A8 in WB, IF\/ICC, IP, ELISA applications and shows reactivity with mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: rat spleen tissue, mouse spleen tissue\nPositive IP detected in: mouse spleen tissue\nPositive IF\/ICC detected in: NIH\/3T3 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:12000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nS100A8 is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and\/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in the inhibition of casein kinase and as a cytokine. S100A8 may form homodimer  or heterodimer with S100A9(16216873).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Eg2959 Product name: recombinant mouse S100a8 protein Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 2-89 aa of NM_013650.2 Sequence: PSELEKALSNLIDVYHNYSNIQGNHHALYKNDFKKMVTTECPQFVQNINIENLFRELDINSDNAINFEEFLAMVIKVGVASHKDSHKE Predict reactive species\nFull Name: S100 calcium binding protein A8 (calgranulin A)\nCalculated Molecular Weight: 10 kDa\nObserved Molecular Weight: 11 kDa\nGenBank Accession Number: NM_013650.2\nGene Symbol: S100a8\nGene ID (NCBI): 20201\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: P27005\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887791493289,"sku":"32681-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-32681-1-ap","provider":"Iright","version":"1.0","type":"link"}