{"product_id":"proteintech-32685-1-ap","title":"Proteintech, 32685-1-AP, OLR1\/LOX1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe OLR1\/LOX1 (32685-1-AP) by Proteintech is a Polyclonal antibody targeting OLR1\/LOX1 in WB, IHC, ELISA applications with reactivity to mouse samples\n32685-1-AP targets OLR1\/LOX1 in WB, IHC, ELISA applications and shows reactivity with mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse lung tissue, PNGF treated mouse lung tissue\nPositive IHC detected in: mouse placenta tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:8000\nImmunohistochemistry (IHC): IHC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nOLR1\/LOX-1 acts as a receptor, in the form of homodimer, that mediates the recognition, internalization, and degradation of oxidatively modified low density lipoprotein (oxLDL) (PMID: 9052782, 15695803). OLR1\/LOX1  is predominantly expressed in endothelial cells and vascular-rich organs such as the placenta, lung, liver, and brain (PMID: 9828121). Mouse OLR1\/LOX1 is type II transmembrane protein containing 363 amino acids and has a cytoplasmic N-terminus and an extracellular C-terminus comprising the neck domain and the ligand-binding domain (CTLD) (PMID: 9588202). The molecular mass of mouse OLR1\/LOX-1 at 65-70 kDa may be a fully glycosylated form, which is reduced to approximately 37 kDa after treatment with the deglycosylase PNGase.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Eg2473 Product name: Recombinant Mouse OLR1\/LOX1 protein (rFc Tag) (HPLC verified) Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 60-363 aa of NM_138648.2 Sequence: RQVSDLLKQYQANLTQQDRILEGQMLAQQKAENTSQESKKELKGKIDTLTQKLNEKSKEQEELLQKNQNLQEALQRAANSSEESQRELKGKIDTITRKLDEKSKEQEELLQMIQNLQEALQRAANSSEESQRELKGKIDTLTLKLNEKSKEQEELLQKNQNLQEALQRAANFSGPCPQDWLWHKENCYLFHGPFSWEKNRQTCQSLGGQLLQINGADDLTFILQAISHTTSPFWIGLHRKKPGQPWLWENGTPLNFQFFKTRGVSLQLYSSGNCAYLQDGAVFAENCILIAFSICQKKTNHLQI Predict reactive species\nFull Name: oxidized low density lipoprotein (lectin-like) receptor 1\nCalculated Molecular Weight: 42 kDa\nObserved Molecular Weight: 65-70 kDa, 37 kDa\nGenBank Accession Number: NM_138648.2\nGene Symbol: Olr1\nGene ID (NCBI): 108078\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q9EQ09\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887745847465,"sku":"32685-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-32685-1-ap","provider":"Iright","version":"1.0","type":"link"}