{"product_id":"proteintech-32690-1-ap","title":"Proteintech, 32690-1-AP, IFNA21 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe IFNA21 (32690-1-AP) by Proteintech is a Polyclonal antibody targeting IFNA21 in WB, ELISA applications with reactivity to human samples\n32690-1-AP targets IFNA21 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Recombinant protein\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nIFNA21, also known as Interferon alpha-21, is a member of the type I interferon family. IFNA21 is produced by macrophages and has antiviral activities. It stimulates the production of two enzymes: a protein kinase and an oligoadenylate synthetase, which contribute to its antiviral effects. IFNA21 may also be involved in inflammatory processes in an age-dependent manner and in the progression of coronary artery disease.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag38296 Product name: Recombinant human IFNA21 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 24-189 aa of BC101638 Sequence: CDLPQTHSLGNRRALILLAQMGRISPFSCLKDRHDFGFPQEEFDGNQFQKAQAISVLHEMIQQTFNLFSTKDSSATWEQSLLEKFSTELNQQLNDLEACVIQEVGVEETPLMNVDSILAVKKYFQRITLYLTEKKYSPCAWEVVRAEIMRSFSLSKIFQERLRRKE Predict reactive species\nFull Name: interferon, alpha 21\nGenBank Accession Number: BC101638\nGene Symbol: IFNA21\nGene ID (NCBI): 3452\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: P01568\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887676444841,"sku":"32690-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-32690-1-ap","provider":"Iright","version":"1.0","type":"link"}