{"product_id":"proteintech-32696-1-ap","title":"Proteintech, 32696-1-AP, F8A2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe F8A2 (32696-1-AP) by Proteintech is a Polyclonal antibody targeting F8A2 in WB, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n32696-1-AP targets F8A2 in WB, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: OVCAR-3 cells, SKOV-3 cells,  mouse brain tissue,  rat brain tissue\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nF8A2 (Coagulation Factor VIII Associated 2) is a protein associated with coagulation factor VIII, which is widely expressed in a variety of cell types, localized mainly in the cytoplasm and nucleus, and also co-localized with Huntington's protein (HTT). Although its specific function is not fully defined, F8A2 may play an important role in intracellular and vesicular transport. In addition, F8A2 co-localizes with ubiquitin in neuronal cells and may be involved in the pathological process of neurodegenerative diseases.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag38529 Product name: Recombinant human F8A2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 20-216 aa of NM_012151.3 Sequence: GDFLARYRLVSNKLKKRFLRKPNVAEAGEQFGQLGRELRAQECLPYAAWCQLAVARCQQALFHGPGEALALTEAARLFLRQERDARQRLVCPAAYGEPLQAAASALGAAVRLHLELGQPAAAAALCLELAAALRDLGQPAAAAGHFQRAAQLQLPQLPLAALQALGEAASCQLLARDYTGALAVFTRMQRLAREHGS Predict reactive species\nFull Name: coagulation factor VIII-associated (intronic transcript) 2\nCalculated Molecular Weight: 39kDa，371aa\nObserved Molecular Weight: 38 kDa\nGenBank Accession Number: NM_012151.3\nGene Symbol: F8A2\nGene ID (NCBI): 474383\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: P23610\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887629062313,"sku":"32696-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-32696-1-ap","provider":"Iright","version":"1.0","type":"link"}