{"product_id":"proteintech-32715-1-ap","title":"Proteintech, 32715-1-AP, RNF183 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe RNF183 (32715-1-AP) by Proteintech is a Polyclonal antibody targeting RNF183 in WB, ELISA applications with reactivity to human samples\n32715-1-AP targets RNF183 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: 5637 cells, HCT 116 cells,  HT-29 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nRNF183, or Ring Finger Protein 183, is a member of the RING finger protein family that functions as a ubiquitin ligase. RNF183 exhibits tissue-specific expression patterns, with higher expression levels in the gall bladder, kidney, and other tissues. RNF183 expression levels are increased in patients with IBD, including Crohn's disease and ulcerative colitis (PMID: 32486221). It promotes intestinal inflammation by increasing the ubiquitination and degradation of IkappaBalpha, thereby inducing NF-kappaB activation (PMID: 31889078). RNF183 has also been implicated in other conditions such as chronic kidney disease and Alzheimer's disease.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag36228 Product name: Recombinant human RNF183 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-161 aa of BC013036 Sequence: MAEQQGRELEAECPVCWNPFNNTFHTPKMLDCCHSFCVECLAHLSLVTPARRRLLCPLCRQPTVLASGQPVTDLPTDTAMLTLLRLEPHHVILEGHQLCLKDQPKSRYFLRQPRVYTLDLGPQPGGQTGPPPDTASATVSTPILIPSHHSLRECFRNPQFR Predict reactive species\nFull Name: ring finger protein 183\nObserved Molecular Weight: 30 kDa\nGenBank Accession Number: BC013036\nGene Symbol: RNF183\nGene ID (NCBI): 138065\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q96D59\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887786512553,"sku":"32715-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-32715-1-ap","provider":"Iright","version":"1.0","type":"link"}