{"product_id":"proteintech-32743-1-ap","title":"Proteintech, 32743-1-AP, Tnfsf18 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Tnfsf18 (32743-1-AP) by Proteintech is a Polyclonal antibody targeting Tnfsf18 in IHC, ELISA applications with reactivity to mouse samples\n32743-1-AP targets Tnfsf18 in IHC, ELISA applications and shows reactivity with mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: mouse spleen tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTnfsf18 (Tumor necrosis factor ligand superfamily member 18), also known as GITRL (Glucocorticoid-Induced TNF Receptor Ligand), is a cytokine belonging to the tumor necrosis factor (TNF) ligand family. Tnfsf18 regulates T cell activation and the positive regulation of NF-κB transcription factor activity. TNFSF18 has been implicated in various inflammatory conditions.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Eg2850 Product name: Recombinant Mouse TNFSF18 protein (rFc Tag) Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 47-173 aa of NM_183391.3 Sequence: TAIESCMVKFELSSSKWHMTSPKPHCVNTTSDGKLKILQSGTYLIYGQVIPVDKKYIKDNAPFVVQIYKKNDVLQTLMNDFQILPIGGVYELHAGDNIYLKFNSKDHIQKTNTYWGIILMPDLPFIS Predict reactive species\nFull Name: tumor necrosis factor (ligand) superfamily, member 18\nCalculated Molecular Weight: 20 kDa\nGenBank Accession Number: NM_183391.3\nGene Symbol: Tnfsf18\nGene ID (NCBI): 240873\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q7TS55\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887834517673,"sku":"32743-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-32743-1-ap","provider":"Iright","version":"1.0","type":"link"}