{"product_id":"proteintech-32753-1-ap","title":"Proteintech, 32753-1-AP, Beta-2-Microglobulin Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Beta-2-Microglobulin (32753-1-AP) by Proteintech is a Polyclonal antibody targeting Beta-2-Microglobulin in WB, IHC, ELISA applications with reactivity to mouse, rat samples\n32753-1-AP targets Beta-2-Microglobulin in WB, IHC, ELISA applications and shows reactivity with mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse lung tissue, mouse spleen tissue,  rat lung tissue,  rat spleen tissue\nPositive IHC detected in: rat liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nBeta-2-microglobulin (B2M) is a component of MHC class I molecules, which are present on the surface of nearly all nucleated cells. It can be found in body fluids under physiologic conditions as a result of shedding from cell surfaces or intracellular release. B2M has various biological functions, including antigen presentation. Investigations reveal that increased synthesis and release of B2M are present in several malignant diseases.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Eg3270 Product name: Recombinant Rat Beta-2-Microglobulin protein (rFc Tag) (HPLC verified) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 21-119 aa of NM_012512.2 Sequence: IQKTPQIQVYSRHPPENGKPNFLNCYVSQFHPPQIEIELLKNGKKIPNIEMSDLSFSKDWSFYILAHTEFTPTETDVYACRVKHVTLKEPKTVTWDRDM Predict reactive species\nFull Name: beta-2 microglobulin\nCalculated Molecular Weight: 14 kDa\nObserved Molecular Weight: 12-14 kDa\nGenBank Accession Number: NM_012512.2\nGene Symbol: B2m\nGene ID (NCBI): 24223\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: P07151\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46885228871849,"sku":"32753-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-32753-1-ap","provider":"Iright","version":"1.0","type":"link"}