{"product_id":"proteintech-32759-1-ap","title":"Proteintech, 32759-1-AP, CD74 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CD74 (32759-1-AP) by Proteintech is a Polyclonal antibody targeting CD74 in WB, ELISA applications with reactivity to mouse, rat samples\n32759-1-AP targets CD74 in WB, ELISA applications and shows reactivity with mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse spleen tissue, mouse thymus tissue,  rat spleen tissue,  rat thymus tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:12000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCD74, also known as MHC class II invariant chain Ii or HLA-DR-associated invariant chain, is a non-polymorphic type II transmembrane glycoprotein. CD74 is mainly distributed in B cells, monocytes, Langerhans cells, dendritic cells and thymic epithelial cells, and is also expressed in epithelial cells. CD74 plays a key role in MHC class II antigen processing and also serves as a cell surface receptor for the macrophage cytokine MIF. CD74 plays an important role in cardiovascular diseases such as atherosclerosis, ischemic heart disease, and myocardial hypertrophy. (PMID: 15475450; 27752708; 38992165; 36712241).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Eg2716 Product name: Recombinant Mouse Cd74 protein (rFc Tag) Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 56-279 aa of NM_001042605.1 Sequence: QQQGRLDKLTITSQNLQLESLRMKLPKSAKPVSQMRMATPLLMRPMSMDNMLLGPVKNVTKYGNMTQDHVMHLLTRSGPLEYPQLKGTFPENLKHLKNSMDGVNWKIFESWMKQWLLFEMSKNSLEEKKPTEAPPKVLTKCQEEVSHIPAVYPGAFRPKCDENGNYLPLQCHGSTGYCWCVFPNGTEVPHTKSRGRHNCSEPLDMEDLSSGLGVTRQELGQVTL Predict reactive species\nFull Name: CD74 antigen (invariant polypeptide of major histocompatibility complex, class II antigen-associated)\nCalculated Molecular Weight: 32 kDa\nObserved Molecular Weight: 41 kDa, 31 kDa\nGenBank Accession Number: NM_001042605.1\nGene Symbol: Cd74\nGene ID (NCBI): 16149\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: P04441-1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46886318866601,"sku":"32759-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-32759-1-ap","provider":"Iright","version":"1.0","type":"link"}