{"product_id":"proteintech-32773-1-ap","title":"Proteintech, 32773-1-AP, Mesothelin Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Mesothelin (32773-1-AP) by Proteintech is a Polyclonal antibody targeting Mesothelin in WB, ELISA applications with reactivity to human, mouse samples\n32773-1-AP targets Mesothelin in WB, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: MKN-45 cells, HeLa cells,  SW 1990 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMesothelin (MSLN) is a cell surface glycoprotein that was discovered in 1992 by Kai Chang, Ira Pastan, and Mark Willingham at the National Cancer Institute in Bethesda, MD. It is synthesized as a 69-kDa precursor protein, which is cleaved to form two proteins: a membrane-bound MSLN and a soluble megakaryocyte potentiating factor (MPF). MSLN is overexpressed in various tumor types, including mesothelioma, ovarian cancer, pancreatic adenocarcinoma, gastric cancer, and triple-negative breast cancer (TNBC). However, it is expressed at low levels in normal tissues, primarily on the mesothelial cells lining the pleura, pericardium, and peritoneum. (PMID: 37869242)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Eg2864 Product name: Recombinant Mouse Mesothelin protein (rFc Tag)(HPLC verified) Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 298-600 aa of NM_018857.1 Sequence: DAEQKACPPGKEPYKVDEDLIFYQNWELEACVDGTMLARQMDLVNEIPFTYEQLSIFKHKLDKTYPQGYPESLIQQLGHFFRYVSPEDIHQWNVTSPDTVKTLLKVSKGQKMNAQAIALVACYLRGGGQLDEDMVKALGDIPLSYLCDFSPQDLHSVPSSVMWLVGPQDLDKCSQRHLGLLYQKACSAFQNVSGLEYFEKIKTFLGGASVKDLRALSQHNVSMDIATFKRLQVDSLVGLSVAEVQKLLGPNIVDLKTEEDKSPVRDWLFRQHQKDLDRLGLGLQGGIPNGYLVLDFNVREAFS Predict reactive species\nFull Name: mesothelin\nCalculated Molecular Weight: 69 kDa\nObserved Molecular Weight: 46 kDa, 70 kDa\nGenBank Accession Number: NM_018857.1\nGene Symbol: Msln\nGene ID (NCBI): 56047\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q61468\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887717306537,"sku":"32773-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-32773-1-ap","provider":"Iright","version":"1.0","type":"link"}