{"product_id":"proteintech-32776-1-ap","title":"Proteintech, 32776-1-AP, KIR2DS1\/CD158h Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe KIR2DS1\/CD158h (32776-1-AP) by Proteintech is a Polyclonal antibody targeting KIR2DS1\/CD158h in IHC, ELISA applications with reactivity to human samples\n32776-1-AP targets KIR2DS1\/CD158h in IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: human tonsillitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nKiller cell immunoglobulin-like receptors (KIRs) are a diverse family of inhibitory and activating receptors expressed on NK cells and a subset of T cells (PMID: 11861603). These polymorphic receptors interact with specific motifs on HLA class I molecules, modulate NK cytolytic activity and are encoded by genes located on chromosome 19q13.4 (PMID: 17069649). KIR2DS1, also known as CD158h, is a 50 kDa, single-pass glycoprotein consisting of an extracellular region composed of two Ig-like domains, a transmembrane region and a short cytoplasmic tail lacking the ITIM motif (PMID: 8627176). It is expressed on natural killer cells and a subset of T cells. KIR2DS1 is an activating receptor that recognizes HLA-C2 group. KIR2DS1 has been shown to be involved in many disorders including autoimmune diseases, malignancies and pregnancy outcomes (PMID: 28546555).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Eg3717 Product name: recombinant human CD158H\/KIR2DS1 protein Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 22-245 aa of NM_014512.1 Sequence: HEGVHRKPSLLAHPGRLVKSEETVILQCWSDVMFEHFLLHREGMFNDTLRLIGEHHDGVSKANFSISRMKQDLAGTYRCYGSVTHSPYQLSAPSDPLDIVIIGLYEKPSLSAQPGPTVLAGENVTLSCSSRSSYDMYHLSREGEAHERRLPAGTKVNGTFQANFPLGPATHGGTYRCFGSFRDSPYEWSKSSDPLLVSVTGNPSNSWPSPTEPSSETGNPRHLH Predict reactive species\nFull Name: killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 1\nCalculated Molecular Weight: 34 kDa\nGenBank Accession Number: NM_014512.1\nGene Symbol: KIR2DS1\nGene ID (NCBI): 3806\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q14954\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887696793769,"sku":"32776-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-32776-1-ap","provider":"Iright","version":"1.0","type":"link"}