{"product_id":"proteintech-32786-1-ap","title":"Proteintech, 32786-1-AP, Resistin Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Resistin (32786-1-AP) by Proteintech is a Polyclonal antibody targeting Resistin in WB, ELISA applications with reactivity to mouse samples\n32786-1-AP targets Resistin in WB, ELISA applications and shows reactivity with mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse adipose tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nResistin, an adipokine produced in fat tissue, is a cysteine rich protein with a molecular weight of 12 kDa. Resistin inhibits insulin action, signaling, and glucose metabolism. Previous data have suggested that resistin secretion is linked to insulin resistance (IR) and type 2 diabetes. Resistin expression in rodents is limited only to adipocytes, but human resistin is produced mainly by macrophages and monocytes, which show only 59% amino acid homology to mice. (PMID: 34325643, PMID: 32991315)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Eg3391 Product name: Recombinant Mouse Resistin protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-N-rFc Tag: N-rFc Domain: 21-114 aa of NM_001204959.1 Sequence: SSMPLCPIDEAIDKKIKQDFNSLFPNAIKNIGLNCWTVSSRGKLASCPEGTAVLSCSCGSACGSWDIREEKVCHCQCARIDWTAARCCKLQVAS Predict reactive species\nFull Name: resistin\nCalculated Molecular Weight: 12 kDa\nObserved Molecular Weight: 12 kDa\nGenBank Accession Number: NM_001204959.1\nGene Symbol: Retn\nGene ID (NCBI): 57264\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q99P87\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887782842537,"sku":"32786-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-32786-1-ap","provider":"Iright","version":"1.0","type":"link"}