{"product_id":"proteintech-32791-1-ap","title":"Proteintech, 32791-1-AP, TAFA1\/FAM19A1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TAFA1\/FAM19A1 (32791-1-AP) by Proteintech is a Polyclonal antibody targeting TAFA1\/FAM19A1 in WB, ELISA applications with reactivity to human, mouse, rat samples\n32791-1-AP targets TAFA1\/FAM19A1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, rat brain tissue,  rat cerebellum\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTAFA1, also named as FAM19A1, is a secreted protein that belongs to a small family of cytokines characterized by a conserved FAFA (FAM19 and TAFA) structural domain. It is predominantly expressed in specific regions of the central nervous system, particularly the brain. Functionally, TAFA1 acts as a chemokine-like factor, playing a crucial role in regulating immune cell migration and activation within the brain, thereby contributing to neuroimmune communication. Furthermore, growing evidence highlights its significance in various pathological processes, including modulating neuroinflammation, influencing the progression of neurodegenerative diseases, and even exhibiting context-dependent roles in certain cancers. TAFA1\/FAM19A1 can be detected as about 15 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag37253 Product name: Recombinant human FAM19A1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 68-133 aa of BC025746 Sequence: SCLPGKVAGTTRNRPSCVDASIVIGKWWCEMEPCLEGEECKTLPDNSGWMCATGNKIKTTRIHPRT Predict reactive species\nFull Name: family with sequence similarity 19 (chemokine (C-C motif)-like), member A1\nObserved Molecular Weight: 15 kDa\nGenBank Accession Number: BC025746\nGene Symbol: FAM19A1\nGene ID (NCBI): 407738\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q7Z5A9\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887822590121,"sku":"32791-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-32791-1-ap","provider":"Iright","version":"1.0","type":"link"}