{"product_id":"proteintech-32853-1-ap","title":"Proteintech, 32853-1-AP, BMP2K Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe BMP2K (32853-1-AP) by Proteintech is a Polyclonal antibody targeting BMP2K in WB, ELISA applications with reactivity to human samples\n32853-1-AP targets BMP2K in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: K-562 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nBMP2K is an uncharacterized member of NAK family. Structural similarities of kinase domains (75% identical) and in vitro inhibition profiles categorized BMP2K as the closest homolog of AAK1. BMP2K was originally identified as a serine-threonine kinase regulating osteoblast differentiation whose gene product is sharply upregulated by BMP-2 stimulation. Later, various genetic and proteomic screens linked BMP2K to HIV entry, developmental dysplasia of the hip, myopia, leukemia, breast cancer metastasis and so on. Recent multivariate proteomic profiling approaches identified BMP2K as a component of purified CCV from HeLa cells. BMP2K can phosphorylate AP-2 in vitro and in vivo. Functional impairment of BMP2K impedes AP-2 phosphorylation leading to defects in clathrin-coated pit (CCP) morphology and cargo internalization. BMP2K engages AP-2 via its extended C-terminus and this interaction is important for its CCP localization and function (PMID: 34480404).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag36482 Product name: Recombinant human BMP2K protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 495-650 aa of NM_198892.1 Sequence: LLQDAYMQQYQHATQQQQMLQQQFLMHSVYQPQPSASQYPTMMPQYQQAFFQQQMLAQHQPSQQQASPEYLTSPQEFSPALVSYTSSLPAQVGTIMDSSYSANRSVADKEAIANFTNQKNISNPPDMSGWNPFGEDNFSKLTEEELLDREFDLLRS Predict reactive species\nFull Name: BMP2 inducible kinase\nCalculated Molecular Weight: 129kDa，1161aa\nObserved Molecular Weight: 140 kDa\nGenBank Accession Number: NM_198892.1\nGene Symbol: BMP2K\nGene ID (NCBI): 55589\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q9NSY1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46885247975593,"sku":"32853-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-32853-1-ap","provider":"Iright","version":"1.0","type":"link"}