{"product_id":"proteintech-32857-1-ap","title":"Proteintech, 32857-1-AP, APOBEC1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe APOBEC1 (32857-1-AP) by Proteintech is a Polyclonal antibody targeting APOBEC1 in WB, ELISA applications with reactivity to human samples\n32857-1-AP targets APOBEC1 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HepG2 cells, L02 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nApolipoprotein B mRNA-editing enzyme catalytic subunit 1 (APOBEC1) is a member of the cytidine deaminase enzyme family. It forms a multiple-protein editing holoenzyme with APOBEC1 complementation factor (ACF) and APOBEC1 stimulating protein (ASP) (PMID: 30844405). This holoenzyme is involved in the editing of C-to-U nucleotide bases in apolipoprotein B and neurofibromatosis-1 mRNAs (PMID: 24916387; 11727199). APOBEC1 plays a crucial role in RNA editing, which is essential for the proper function of these proteins. Additionally, APOBEC1 has been implicated in various cellular processes, including the regulation of gene expression and the maintenance of genomic stability (PMID: 33094286).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag26715 Product name: Recombinant human APOBEC1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-135 aa of NM_001304566 Sequence: MTSEKGPSTGDPTLRRRIEPWEFDVFYDPRELRKEACLLYEIKWGMSRKIWRSSGKNTTNHVEVNFIKKFTSERDFHPSMSCSITWFLSWSPCWECSQAIREFLSRHPGVTLVIYVARLFWHMDQQNRQGLRDLV Predict reactive species\nFull Name: apolipoprotein B mRNA editing enzyme, catalytic polypeptide 1\nCalculated Molecular Weight: 28 kDa\nObserved Molecular Weight: 25 kDa\nGenBank Accession Number: NM_001304566\nGene Symbol: APOBEC1\nGene ID (NCBI): 339\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: P41238\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46884989960361,"sku":"32857-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-32857-1-ap","provider":"Iright","version":"1.0","type":"link"}