{"product_id":"proteintech-32860-1-ap","title":"Proteintech, 32860-1-AP, SELENOO Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SELENOO (32860-1-AP) by Proteintech is a Polyclonal antibody targeting SELENOO in WB, ELISA applications with reactivity to human samples\n32860-1-AP targets SELENOO in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, HEK-293 cells,  K-562 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:5000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSELENOO (Selenoprotein O) is a selenocysteine-containing (Sec) selenoprotein belonging to the oxidoreductase family, which is mainly localized in the endoplasmic reticulum (ER) membranes with multiple transmembrane structural domains. SELENOO plays important roles in a variety of cellular processes, including redox homeostasis and lipid metabolism and DNA damage repair. It plays an important role in a variety of cellular processes, including redox homeostasis, lipid metabolism, and DNA damage repair. SELENOO is aberrantly expressed in a variety of diseases, including cancer and neurodegenerative diseases. For example, in melanoma and lung cancer, the upregulation of SELENOO expression is associated with tumor progression and metastasis, which has become a hot topic in current research.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag35939 Product name: Recombinant human RP3-402G11.5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 477-666 aa of BC110866 Sequence: LARLMEQCASLEELRLAFRPQMDPRQLSMMLMLAQSNPQLFALMGTRAGIARELERVEQQSRLEQLSAAELQSRNQGHWADWLQAYRARLDKDLEGAGDAAAWQAEHVRVMHANNPKYVLRNYIAQNAIEAAERGDFSEVRRVLKLLETPYHCEAGAATDAEATEADGADGRQRSYSSKPPLWAAELCVT Predict reactive species\nFull Name: selenoprotein O\nObserved Molecular Weight: 70 kDa\nGenBank Accession Number: BC110866\nGene Symbol: RP3-402G11.5\nGene ID (NCBI): 83642\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q9BVL4\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887796015273,"sku":"32860-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-32860-1-ap","provider":"Iright","version":"1.0","type":"link"}