{"product_id":"proteintech-32867-1-ap","title":"Proteintech, 32867-1-AP, MAGOHB Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MAGOHB (32867-1-AP) by Proteintech is a Polyclonal antibody targeting MAGOHB in WB, ELISA applications with reactivity to human samples\n32867-1-AP targets MAGOHB in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, Jurkat cells,  Raji cells,  Ramos cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMago Homolog B, Exon Junction Complex Subunit (MAGOHB), is a key component of the exon junction complex (EJC), which is crucial for pre-mRNA splicing, mRNA transport, and nonsense-mediated decay (NMD). It plays a redundant role with MAGOH in the EJC and is required for proper mRNA processing and translation (PMID: 23917022). Additionally, MagoHB is involved in multiple biological processes, including neurogenesis, brain development, cell cycle regulation, and apoptosis (PMID: 37294214).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag37296 Product name: Recombinant human MAGOHB protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-116 aa of BC010905 Sequence: MAVASDFYLRYYVGHKGKFGHEFLEFEFRPDGKLRYANNSNYKNDVMIRKEAYVHKSVMEELKRIIDDSEITKEDDALWPPPDRVGRQELEIVIGDEHISFTTSKIGSLIDVNQSK Predict reactive species\nFull Name: mago-nashi homolog B (Drosophila)\nCalculated Molecular Weight: 17 kDa\nObserved Molecular Weight: 15 kDa\nGenBank Accession Number: BC010905\nGene Symbol: MAGOHB\nGene ID (NCBI): 55110\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q96A72\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887711867049,"sku":"32867-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-32867-1-ap","provider":"Iright","version":"1.0","type":"link"}