{"product_id":"proteintech-32890-1-ap","title":"Proteintech, 32890-1-AP, ADAMTS19 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ADAMTS19 (32890-1-AP) by Proteintech is a Polyclonal antibody targeting ADAMTS19 in IHC, ELISA applications with reactivity to human, mouse samples\n32890-1-AP targets ADAMTS19 in IHC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nADAMTS19 encodes a member of the ADAMTS (a disintegrin and metalloproteinase domain with thrombospondin motifs) protein family with emerging roles in carcinogenesis and metastasis. ADAMTS shares several distinct protein modules including a propeptide region, a metalloproteinase domain, a disintegrin-like domain, and a thrombospondin type 1 (TS) motif.  The promoter of ADAMTS19 is targeted by hypermethylation in a significant proportion of gastrointestinal cancers, particularly in BRAF-mutant cancers, and that this hypermethylation associates with transcriptional downregulation and reduces the in vitro migration capabilities of Colorectal cancer cells (PMID: 26634009).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag36946 Product name: Recombinant human ADAMTS19 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 580-750 aa of NM_133638 Sequence: CQEMQHVICTGLWCKVEGEKECRTKLDPPMDGTDCDLGKWCKAGECTSRTSAPEHLAGEWSLWSPCSRTCSAGISSRERKCPGLDSEARDCNGPRKQYRICENPPCPAGLPGFRDWQCQAYSVRTSSPKHILQWQAVLDEEKPCALFCSPVGKEQPILLSEKVMDGTSCGY Predict reactive species\nFull Name: ADAM metallopeptidase with thrombospondin type 1 motif, 19\nCalculated Molecular Weight: 134kDa\nGenBank Accession Number: NM_133638\nGene Symbol: ADAMTS19\nGene ID (NCBI): 171019\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q8TE59\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869802713257,"sku":"32890-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-32890-1-ap","provider":"Iright","version":"1.0","type":"link"}