{"product_id":"proteintech-32902-1-ap","title":"Proteintech, 32902-1-AP, GFOD1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe GFOD1 (32902-1-AP) by Proteintech is a Polyclonal antibody targeting GFOD1 in WB, ELISA applications with reactivity to human, mouse samples\n32902-1-AP targets GFOD1 in WB, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: fetal human brain tissue, mouse brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGlucose-fructose oxidoreductase domain 1 (GFOD1), may be linked to the development of ADHD. It plays a role in regulating oxidative stress in ADHD. GFOD1 may contribute to increased levels of oxidative stress specifically in the prefrontal cortex and cerebellar cortex regions and astrocytes affected by ADHD via up-regulation of the NF-κB p65\/NOX2\/oxidative stress axis (PMID: 40210145). There is a signal peptide at the N-terminal of this protein and the detected double strand in fetal human brain tissue is consistent with PMID: 38946427.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag37656 Product name: Recombinant human GFOD1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 272-390 aa of BC119005 Sequence: APEQELLVQDATPVSNSLLPEKAFSDIPSPYLRGTIKMMQAVRQAFQDQDDRRTWDGRPLTMAATFDDCLYALCVVDTIKRSSQTGEWQNIAIMTEEPELSPAYLISEAMRRSRMSLYC Predict reactive species\nFull Name: glucose-fructose oxidoreductase domain containing 1\nCalculated Molecular Weight: 390 aa, 43 kDa\nObserved Molecular Weight: 43 kDa\nGenBank Accession Number: BC119005\nGene Symbol: GFOD1\nGene ID (NCBI): 54438\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q9NXC2\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887649869993,"sku":"32902-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-32902-1-ap","provider":"Iright","version":"1.0","type":"link"}