{"product_id":"proteintech-32904-1-ap","title":"Proteintech, 32904-1-AP, ZCWPW2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ZCWPW2 (32904-1-AP) by Proteintech is a Polyclonal antibody targeting ZCWPW2 in WB, ELISA applications with reactivity to human samples\n32904-1-AP targets ZCWPW2 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, Jurkat cells,  U-251 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nZCWPW2 (Zinc Finger CW-type and PWWP Domain Containing 2) is a protein containing CW-type zinc finger and PWWP domains. It mainly serves as a histone methylation \"reader\" protein that binds lysine 4 (H3K4me0, H3K4me1, H3K4me3) in different methylation states on histone H3, and is involved in the regulation of chromatin structure and gene expression. In addition, ZCWPW2 protein plays an important role in meiosis and germ cell development, and its function is closely related to PRDM9 protein, which may be a key interacting protein in the mechanism of double-strand break repair or recombination.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag36666 Product name: Recombinant human ZCWPW2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 250-356 aa of BC094696 Sequence: VYSDDALSKENRVVCETEVLLKELEQMLQQALQPTATPDESEEGHGEEINMGEKLSKCSPEAPAGSLFENHYEEDYLVIDGIKLKAGECIEDITNKFKEIDALMSEF Predict reactive species\nFull Name: zinc finger, CW type with PWWP domain 2\nObserved Molecular Weight: 47 kDa\nGenBank Accession Number: BC094696\nGene Symbol: ZCWPW2\nGene ID (NCBI): 152098\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q504Y3\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887927939241,"sku":"32904-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-32904-1-ap","provider":"Iright","version":"1.0","type":"link"}