{"product_id":"proteintech-32918-1-ap","title":"Proteintech, 32918-1-AP, C3orf22 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe C3orf22 (32918-1-AP) by Proteintech is a Polyclonal antibody targeting C3orf22 in WB, ELISA applications with reactivity to human samples\n32918-1-AP targets C3orf22 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse testis tissue, rat tsetis tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nC3orf22 is a gene located on chromosome 3 that encodes a protein known as Chromosome 3 Open Reading Frame 22. During embryonic development, C3orf22 is expressed in various tissues and organs, such as the brain, heart, and limbs. Its expression may be regulated by developmental stage-specific factors and signaling pathways.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag38384 Product name: Recombinant human C3orf22 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-141 aa of BC032025 Sequence: MDSSACKKSHQSKKWRIQAQENFAKKFPYRLSWLTEPDPEPLQPWEVTNDSNTVQLPLQKRLVPTRSIPVRGLGAPDFTSPSGSCPAPLPAPSPPPLCNLWELKLLSRRFPRQLAFLLSTRHTEAACPQTSKAAGLSRGLS Predict reactive species\nFull Name: chromosome 3 open reading frame 22\nCalculated Molecular Weight: 141 aa, 16 kDa\nObserved Molecular Weight: 21 kDa\nGenBank Accession Number: BC032025\nGene Symbol: C3orf22\nGene ID (NCBI): 152065\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q8N5N4\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46885609865385,"sku":"32918-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-32918-1-ap","provider":"Iright","version":"1.0","type":"link"}