{"product_id":"proteintech-32923-1-ap","title":"Proteintech, 32923-1-AP, CHD1L Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CHD1L (32923-1-AP) by Proteintech is a Polyclonal antibody targeting CHD1L in WB, ELISA applications with reactivity to human samples\n32923-1-AP targets CHD1L in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, HEK-293 cells,  HeLa cells,  HepG2 cells,  MOLT-4 cells,  U2OS cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCHD1L (Chromodomain Helicase DNA Binding Protein 1-Like), also known as ALC1 (Amplified in Liver Cancer 1), encodes a multifunctional protein involved in various cellular processes such as chromatin remodeling, cell differentiation, and development. CHD1L acts as an ATP-dependent chromatin remodeling enzyme with an ATPase catalytic domain activated by double-stranded DNA. It interacts with PARP1 (poly-ADP-ribose polymerase 1) to promote chromatin relaxation at DNA damage sites, facilitating DNA repair. Overexpression of CHD1L leads to dysregulation of downstream targets in various cancers.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag38526 Product name: Recombinant human CHD1L protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 704-897 aa of NM_004284.5 Sequence: SAELDYQDPDATSLKYVSGDVTHPQAGAEDALIVHCVDDSGHWGRGGLFTALEKRSAEPRKIYELAGKMKDLSLGGVLLFPVDDKESRNKGQDLLALIVAQHRDRSNVLSGIKMAALEEGLKKIFLAAKKKKASVHLPRIGHATKGFNWYGTERLIRKHLAARGIPTYIYYFPRSKSAVLHSQSSSSSSRQLVP* Predict reactive species\nFull Name: chromodomain helicase DNA binding protein 1-like\nCalculated Molecular Weight: 101kDa，897aa\nObserved Molecular Weight: 101 kDa\nGenBank Accession Number: NM_004284.5\nGene Symbol: CHD1L\nGene ID (NCBI): 9557\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q86WJ1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46886504497321,"sku":"32923-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-32923-1-ap","provider":"Iright","version":"1.0","type":"link"}