{"product_id":"proteintech-32924-1-ap","title":"Proteintech, 32924-1-AP, RBM18 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe RBM18 (32924-1-AP) by Proteintech is a Polyclonal antibody targeting RBM18 in WB, ELISA applications with reactivity to human samples\n32924-1-AP targets RBM18 in  applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: K-562 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nRBM18 (RNA Binding Motif Protein 18) functions as an RNA-binding protein and plays roles in various biological processes, including mRNA processing, cell cycle regulation, and ribosome assembly. Additionally, RBM18 is involved in transcriptional regulation and signal transduction.\nIn cancer research, the expression levels of RBM18 are associated with the invasive and metastatic capabilities of tumors. For instance, RBM18 may act as a tumor suppressor in certain types of cancer by regulating the expression of specific genes to inhibit tumor cell proliferation. Therefore, RBM18 is considered a potential tumor suppressor.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag38618 Product name: Recombinant human RBM18 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-190 aa of NM_033117.3 Sequence: MEAETKTLPLENASILSEGSLQEGHRLWIGNLDPKITEYHLLKLLQKFGKVKQFDFLFHKSGALEGQPRGYCFVNFETKQEAEQAIQCLNGKLALSKKLVVRWAHAQVKRYDHNKNDKILPISLEPSSSTEPTQSNLSVTAKIKAIEAKLKMMAENPDAEYPAAPVYSYFKPPDKKRTTPYSRTAWKSRR* Predict reactive species\nFull Name: RNA binding motif protein 18\nCalculated Molecular Weight: 22kDa，190aa\nObserved Molecular Weight: 22 kDa\nGenBank Accession Number: NM_033117.3\nGene Symbol: RBM18\nGene ID (NCBI): 92400\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q96H35\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887780122793,"sku":"32924-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-32924-1-ap","provider":"Iright","version":"1.0","type":"link"}