{"product_id":"proteintech-32933-1-ap","title":"Proteintech, 32933-1-AP, C14orf73 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe C14orf73 (32933-1-AP) by Proteintech is a Polyclonal antibody targeting C14orf73 in WB, ELISA applications with reactivity to human, mouse samples\n32933-1-AP targets C14orf73 in  applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, U-251 cells,  mouse liver tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:8000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nC14orf73 (chromosome 14 open reading frame 73), also known as EXOC3L4 or SEC6-like protein C14orf73, is a protein composed of 722 amino acids and belongs to the SEC6 family. This protein is a component of the exocyst complex, which plays an important role in the cellular secretion process, participating in vesicle targeting and fusion. The C14orf73 protein is predicted to have SNARE binding activity, involved in the localization of the exocyst complex and exocytosis. Additionally, rare variants in the splicing regulatory elements of this gene are associated with Alzheimer's disease.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag35995 Product name: Recombinant human C14orf73 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-255 aa of BC113655 Sequence: MPSPQTDTPGPELQSPKEAEEPQTPAQGSRRTSSRKEPNAHRKDGTRLGLGSLRQAFSRASQRALTQVSKEDTGLFWRSSCSLFRSFRQALNEGPATGHSQATPEVPSGVMNGVSQQASTGAASEELKPEAEGKSVADLITERQLLAAFEQLLRLETLLVAEKASRTFEQDPTAFARRAMDVCLHYDGLAAEIGAIVRETLDSDGVDAAALAELARVVSAEEEAHPSPPDDGDFLRTPRRWRQHWEEAVRRSAQE Predict reactive species\nFull Name: chromosome 14 open reading frame 73\nObserved Molecular Weight: 80 kDa\nGenBank Accession Number: BC113655\nGene Symbol: C14orf73\nGene ID (NCBI): 91828\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q17RC7\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46885438062761,"sku":"32933-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-32933-1-ap","provider":"Iright","version":"1.0","type":"link"}