{"product_id":"proteintech-32958-1-ap","title":"Proteintech, 32958-1-AP, LAMTOR4  Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe LAMTOR4  (32958-1-AP) by Proteintech is a Polyclonal antibody targeting LAMTOR4  in WB, IP, ELISA applications with reactivity to human samples\n32958-1-AP targets LAMTOR4  in WB, IP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, LNCaP cells,  PANC-1 cells\nPositive IP detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\n\u003cb\u003eBackground Information\u003c\/b\u003e\nLate endosomal\/lysosomal adaptor and MAPK and MTOR activator 4 (LAMTOR4)  is a protein belonging to the LAMTOR family and believed to be involved in cell cycle, proliferation, and growth (PMID: 29138253). LAMTOR4 has been reported as a regulator complex that acts as an activator of rapamycin complex 1 (mTORC1) by sensing changes in the levels of amino acids (PMID: 33429026). It might offer a strategy to inhibit tumor progression and metastasis in prostate cancer (PMID: 39125671).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag39105 Product name: Recombinant human C7orf59 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-99 aa of BC130553 Sequence: MTSALTQGLERIPDQLGYLVLSEGAVLASSGDLENDEQAASAISELVSTACGFRLHRGMNVPFKRLSVVFGEHTLLVTVSGQRVFVVKRQNRGREPIDV Predict reactive species\nFull Name: chromosome 7 open reading frame 59\nCalculated Molecular Weight: 11 kDa\nObserved Molecular Weight: 11 kDa\nGenBank Accession Number: BC130553\nGene Symbol: C7orf59\nGene ID (NCBI): 389541\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q0VGL1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887701250217,"sku":"32958-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-32958-1-ap","provider":"Iright","version":"1.0","type":"link"}